This is a working overview of mass spectrometry, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-07-15 and is reviewed periodically as new material appears.
Regulatory treatment of AOD-9604 has varied. In sports anti-doping, the peptide became widely discussed during a 2013 investigation into an Australian professional sports club. Authorities at the time debated whether it fell under prohibitions on growth hormone and related substances. Later clarifications and updated lists have addressed the compound in different ways. Anyone seeking current status should consult the latest applicable rules, and commercial supply for human use is not authorized in major markets.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.
AOD-9604 is a synthetic peptide whose sequence is modeled on the C-terminal region of human growth hormone. Published descriptions commonly place it as a modified fragment corresponding to hGH amino acids 176–191, with a tyrosine residue added or retained at the N-terminus to support detection and handling. It is not intact growth hormone and lacks the full receptor-binding architecture of the parent protein. The molecule was developed as a research candidate for metabolic studies rather than as a replacement for growth hormone therapy. Its identity is defined by its amino acid sequence rather than by any single commercial preparation.
| Property | Value | Notes |
|---|---|---|
| Primary research area | Obesity and metabolic regulation | Studied in cell, animal, and human models |
| Highest reported trial phase | Phase II | Public summaries describe mixed results |
| Common route in trials | Subcutaneous injection | Typical for peptide therapeutics |
| Regulatory example | 2013 Australian anti-doping review | Classification was debated at the time |
| Approval status | Not approved as a human medicine | Status can change by jurisdiction |
Detection of AOD-9604 in biological samples relies on analytical techniques capable of distinguishing a small synthetic peptide from related endogenous sequences. Liquid chromatography coupled with tandem mass spectrometry is commonly used for confirmatory analysis. Sample preparation may involve immunoaffinity enrichment or solid-phase extraction to concentrate the peptide. Because the molecule is small and may be present at low concentrations, assay sensitivity and specificity are ongoing analytical challenges. Laboratories also validate methods against reference materials when available.
Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
Regulatory status: AOD-9604 is not approved as a therapeutic drug in the United States, European Union, or other major markets. It is listed by the World Anti-Doping Agency as a prohibited substance in sport, specifically under growth hormone fragments. Many jurisdictions restrict its sale for human consumption. Products marketed online may not meet pharmaceutical quality standards. The legal status varies by country and often depends on whether the material is presented as a research chemical, supplement, or drug.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography and mass spectrometry. Reversed-phase HPLC separates the peptide from related impurities and can estimate purity by ultraviolet absorbance, while mass spectrometry confirms the molecular mass and detects modifications. Peptide mapping, amino acid analysis, and disulfide mapping may be used when the sequence or disulfide arrangement must be verified. Because AOD9604 contains cysteine residues, oxidation and disulfide isomers are possible quality concerns in synthetic batches.
Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.
Nevertheless, the European judges acknowledged the Advocate General's concerns, stating that there must be clear procedures to allow substances to be added to the permitted list based on scientific evidence. They also said that any refusal to add the product to the list must be open to challenge in the courts.
Designed for the Kill: The Jet Fighter—Development and Experience. United States Naval Institute, 1995, ISBN 0-87021-059-9. Stevenson, James. The Pentagon Paradox: The Development of the F-18 Hornet. Naval Institute Press, 1993, ISBN 1-55750-775-9. Tillman, Barrett. Hellcat Aces of World War 2. London: Osprey Aerospace, 1996. ISBN 1-85532-596-9. United States Air Force Museum Guidebook. Wright-Patterson AFB, Ohio: Air Force Museum Foundation, 1975. United States Army Air Force. AN 01-60JE-2: Maintenance and Erection Instructions for Army Model P-51D-5, −10, −15, 20, −25; P-51K-1, −5, −10, −15; British Model Mustang IV Aeroplanes. Evansville, Indiana: U.S.A.A.F, 1944. Wagner, Ray. American Combat Planes of the 20th Century. Reno, Nevada: Jack Bacon & Company, 2004. ISBN 978-0-930083-17-5. Wagner, Ray. Mustang Designer: Edgar Schmued and the P-51. Herndon, Virginia: Smithsonian Institution Press, 2000. ISBN 978-1-56098-994-3. Walker, Jeff. "Empire of the Sun." Air Classics, Volume 24, Number 1, January 1988. White, Graham. Allied Aircraft Piston Engines of World War II. Warrendale, Pennsylvania: Society for Automotive Engineers, 1995. ISBN 1-56091-655-9. Wilson, Stewart, ed. "Mustang Warbirds: Civil Registered Mustangs of Australia and New Zealand Then and Now." Warbirds of Australia and New Zealand 2010. St Leonards, New South Wales, Australia: Chevron Publishing Group, 2010. Wixey, Ken. "Magnificent Mustang: A Production History of the North American P-51." Air Enthusiast, Issue 95, September/October 2001. Yenne, Bill: Rockwell: The Heritage of North American.
Firearms is a first-person shooter mod for Half-Life which originated from a Quake modification. Initially developed in 1998, Firearms was created as a quasi-realistic team-based FPS. The mod's main feature is the large amount of usable weapons in the game.
==== Altered oxygen sensing ==== Rare inherited mutations in three genes which all result in increased stability of hypoxia-inducible factors, leading to increased erythropoietin production, have been shown to cause secondary polycythemia:
==== Cognitive behavioral therapy ==== Cognitive behavioral therapy (CBT) is useful in adolescents and adults with anorexia nervosa. One of the most known psychotherapy in the field is CBT-E, an enhanced cognitive-behavior therapy specifically focus to eating disorder psychopathology. Acceptance and commitment therapy is a third-wave cognitive-behavioral therapy which has shown promise in the treatment of AN. Cognitive remediation therapy (CRT) is also used in treating anorexia nervosa. Schema-Focused Therapy (a form of CBT) was developed by Dr. Jeffrey Young and is effective in helping patients identify origins and triggers for disordered eating.
Sources: en.wikipedia.org
=== Agriculture === Similar to other areas, Ningxia has seen a gradual decline of its peasant population due to rural–urban migration. Despite this, the great majority (62.8 percent) was still agricultural at the time of the survey. Animal husbandry is important for the regional economy. In the main pastoral county, Yanchi, it is even the leading industry when specified for the primary sector. The dominant grazing animals are sheep and goat. In the (semi-)pastoral regions, herders engage in a mixed sedentary farming operation of dryland agriculture and extensive animal husbandry, while full nomadic pastoralism is no longer practiced. Since a cattle breeding plan was implemented in 2002, the province has become one of China's main dairy production areas. Ningxia is the principal region of China where wolfberries are grown. Other specialties of Ningxia are licorice, products made from Helan stone, fiddlehead and products made from sheepskin. Ningxia wines are a promising area of development. The Chinese authorities have given approval to the development of the eastern base of the Helan Mountains as an area suitable for wine production. Several large Chinese wine companies including Changyu and Dynasty Wine have begun development in the western region of the province. Together they now own 20,000 acres of land for wine plantations and Dynasty has ploughed 100 million yuan into Ningxia. In addition, the major oil company China Petroleum and Chemical Corporation has founded a grape plantation near the Helan Mountains.
== Target == Phrixotoxin-1 and -2 bind to A-type, transient, voltage-gated potassium channels, near the S3 and S4 segments, where they negatively affect transmembrane movement of the voltage sensing domain in response to depolarizing voltages. They bind preferentially to the closed or inactivated state of Kv4.2 and Kv4.3 channels(Chagot 2004). Phrixotoxin-3 (PaurTx3) inhibits several voltage gated sodium channel subtypes (Nav1.1/SCN1A, Nav1.2/SCN2A, Nav1.4/SCN4A, Nav1.5/SCN5A, and Nav1.8/SCN10A) (Bosmans 2006).
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Diethyl maleate is an organic compound with the CAS Registry number 141-05-9. It is chemically a maleate ester with the formula C8H12O4. It is a colorless liquid at room temperature. It has the IUPAC name of diethyl (Z)-but-2-enedioate.
Sources: en.wikipedia.org
==== Dark Messiah of Might and Magic (2006) and cancelled projects ==== Antonov joined French developer Arkane Studios. He was a level designer for their 2006 action role-playing game (RPG) Dark Messiah of Might And Magic, helping his team replicate Valve's process of making levels for Half-Life 2. Around 2007 and 2008, Arkane began developing an officially licensed Half-Life sequel, centered around the alien zombies that infest the ghost town of Ravenholm in Half-Life 2. Antonov continued helping Arkane replicate Valve's design process. The project was soon scrapped, because they did not develop it in the time that Valve wanted, and Valve was having trouble deciding where Half-Life as a series should go while making its episodic entries. Arkane's then-president Raphaël Colantonio has said that Antonov's work on the project "was pivotal to what would become Arkane later", as "he trained us in all of [Valve's] practices in terms of art, in terms of how to think of a level, [and] how to think of architecture". Antonov was a level designer for the studio's next project, an FPS titled The Crossing, for which he created a sci-fi version of Paris. In 2009, this project was also cancelled, as Arkane was unable to secure financing for it, as well as a publisher that would let them retain the game's intellectual property rights in the future. However, elements of The Crossing later came to fruition in Arkane's 2021 FPS Deathloop.
=== Lysostaphin === The lysostaphin test is used to differentiate between Staphylococcus and Micrococcus bacteria. Lysostaphin can lyse Staphylococcus, but Micrococcus bacteria are resistant to the chemical.
Tissue samples of the St. Augustine Monster were re-examined in 2004 for comparison with the more recently discovered Chilean Blob. Sections were observed with an electron microscope, underwent biochemical analyses, and DNA extraction was attempted but extraction of useful DNA from the sample failed. The results of the study confirmed the findings in the 1995 analysis (Pierce et al. 1995) that the blobs were made of collagen, and were definitively the remains of whale carcasses.
==== Metal ions ==== Several metal cations have high affinities for imidazole, the functional group of the His-tag. Divalent cation M2+ (M = Mn, Fe, Co, Ni, Cu, Zn etc) transition metal imidazole complexes are most frequently used for this purpose. The choice of cation is generally a compromise between binding capacity and purity. Nickel is often used as it offers a good balance between these factors, while cobalt can be used when it is desired to increase the purity of purification as it has less affinity for endogenous proteins; binding capacity however is lower compared with nickel.
CO2 + 2 e− + 2 H+ → CO + H2O The redox potential for this reaction near pH 7 is about −0.53 V versus the standard hydrogen electrode. The nickel-containing enzyme carbon monoxide dehydrogenase catalyses this process. Photoautotrophs (i.e. plants and cyanobacteria) use the energy contained in sunlight to photosynthesize simple sugars from CO2 absorbed from the air and water:
Sources: en.wikipedia.org
No major medicines regulator appears to have approved AOD-9604 for human therapeutic use. It has been studied in clinical trials, but those programs did not result in a marketed drug.
It became prominent during a 2013 Australian sports investigation that examined whether it was a prohibited growth-hormone-related substance. Subsequent interpretations and list updates have varied, so current rules should be checked directly.
Published summaries generally report limited or inconsistent weight-loss effects, and complete trial data are not widely available. The studies were not sufficient to establish it as an effective obesity treatment.
No. It is a synthetic peptide fragment modeled on part of human growth hormone, not the full hormone. It does not contain the complete sequence or receptor-binding regions of hGH.